Lineage for d1cjpc_ (1cjp C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778280Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2778302Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (74 PDB entries)
    Uniprot P81461
  8. 2778381Domain d1cjpc_: 1cjp C: [24000]
    complexed with ca, mn, mug

Details for d1cjpc_

PDB Entry: 1cjp (more details), 2.78 Å

PDB Description: concanavalin a complex with 4'-methylumbelliferyl-alpha-d-glucopyranoside
PDB Compounds: (C:) concanavalin a

SCOPe Domain Sequences for d1cjpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjpc_ b.29.1.1 (C:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1cjpc_:

Click to download the PDB-style file with coordinates for d1cjpc_.
(The format of our PDB-style files is described here.)

Timeline for d1cjpc_: