SCOPe 2.06: Domain d4asuf1: 4asu F:9-81

Lineage for d4asuf1 (4asu F:9-81)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (11 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries)

8. Domain d4asuf1: 4asu F:9-81 [239991]
   Other proteins in same PDB: d4asua1, d4asua2, d4asua3, d4asub1, d4asub2, d4asub3, d4asuc1, d4asuc2, d4asuc3, d4asud2, d4asud3, d4asue2, d4asue3, d4asuf2, d4asuf3, d4asug_, d4asui_
   automated match to d1mabb2
   complexed with adp, mg

Details for d4asuf1

PDB Entry: 4asu, 2.6 Å

PDB Description: F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site

PDB Compounds: (F:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d4asuf1:

Sequence; same for both SEQRES and ATOM records:

>d4asuf1 b.49.1.0 (F:9-81) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d4asuf1:

• d4asuf1 first appeared in SCOPe 2.04
  
• d4asuf1 appears in SCOPe 2.05
  
• d4asuf1 appears in SCOPe 2.07
  
• d4asuf1 appears in the current release, SCOPe 2.08