Lineage for d4asue3 (4asu E:358-474)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739159Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1739160Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1739288Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 1739289Protein automated matches [254528] (7 species)
    not a true protein
  7. 1739345Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)
  8. 1739368Domain d4asue3: 4asu E:358-474 [239990]
    Other proteins in same PDB: d4asua1, d4asua2, d4asua3, d4asub1, d4asub2, d4asub3, d4asuc1, d4asuc2, d4asuc3, d4asud1, d4asud2, d4asue1, d4asue2, d4asuf1, d4asuf2, d4asug_, d4asui_
    automated match to d1mabb1
    complexed with adp, mg

Details for d4asue3

PDB Entry: 4asu (more details), 2.6 Å

PDB Description: F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site
PDB Compounds: (E:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d4asue3:

Sequence, based on SEQRES records: (download)

>d4asue3 a.69.1.0 (E:358-474) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Sequence, based on observed residues (ATOM records): (download)

>d4asue3 a.69.1.0 (E:358-474) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdilseedkltvsrarkiqrflsqpfqvaevft
ghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOPe Domain Coordinates for d4asue3:

Click to download the PDB-style file with coordinates for d4asue3.
(The format of our PDB-style files is described here.)

Timeline for d4asue3: