Lineage for d4asud3 (4asu D:358-475)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717574Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)
  8. 2717596Domain d4asud3: 4asu D:358-475 [239987]
    Other proteins in same PDB: d4asua1, d4asua2, d4asua3, d4asub1, d4asub2, d4asub3, d4asuc1, d4asuc2, d4asuc3, d4asud1, d4asud2, d4asue1, d4asue2, d4asuf1, d4asuf2, d4asug_, d4asui_
    automated match to d1mabb1
    complexed with adp, mg

Details for d4asud3

PDB Entry: 4asu (more details), 2.6 Å

PDB Description: F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site
PDB Compounds: (D:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d4asud3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4asud3 a.69.1.0 (D:358-475) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

SCOPe Domain Coordinates for d4asud3:

Click to download the PDB-style file with coordinates for d4asud3.
(The format of our PDB-style files is described here.)

Timeline for d4asud3: