SCOPe 2.04: Domain d4asie1: 4asi E:1620-1943

Lineage for d4asie1 (4asi E:1620-1943)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (46 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)

8. Domain d4asie1: 4asi E:1620-1943 [239981]
   automated match to d4asib1

Details for d4asie1

PDB Entry: 4asi, 2.8 Å

PDB Description: crystal structure of human acaca c-terminal domain

PDB Compounds: (E:) Acetyl-CoA carboxylase 1

SCOPe Domain Sequences for d4asie1:

Sequence; same for both SEQRES and ATOM records:

>d4asie1 c.14.1.0 (E:1620-1943) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplpsdmltytelvlddq
gqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrigsfgpqedllflra
selaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyrylyltpqdykrvs
alnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagesslayneiitislvtc
raigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnqlggiqimhnngvth
ctvcddfegvftvlhwlsympksv

Timeline for d4asie1:

• d4asie1 is new in SCOPe 2.04-stable
  
• d4asie1 appears in SCOPe 2.05
  
• d4asie1 appears in the current release, SCOPe 2.08