Lineage for d4asid1 (4asi D:1618-1943)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853751Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)
  8. 2853772Domain d4asid1: 4asi D:1618-1943 [239979]
    automated match to d4asib1

Details for d4asid1

PDB Entry: 4asi (more details), 2.8 Å

PDB Description: crystal structure of human acaca c-terminal domain
PDB Compounds: (D:) Acetyl-CoA carboxylase 1

SCOPe Domain Sequences for d4asid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4asid1 c.14.1.0 (D:1618-1943) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dllqskrfqaqslgttyiydipemfrqsliklwesmstqaflpspplpsdmltytelvld
dqgqlvhmnrlpggneigmvawkmtfkspeypegrdiivigndityrigsfgpqedllfl
raselaraegipriyvsansgariglaeeirhmfhvawvdpedpykgyrylyltpqdykr
vsalnsvhcehvedegesrykitdiigkeegigpenlrgsgmiagesslayneiitislv
tcraigigaylvrlgqrtiqvenshliltgagalnkvlgrevytsnnqlggiqimhnngv
thctvcddfegvftvlhwlsympksv

SCOPe Domain Coordinates for d4asid1:

Click to download the PDB-style file with coordinates for d4asid1.
(The format of our PDB-style files is described here.)

Timeline for d4asid1: