SCOPe 2.05: Domain d4andb_: 4and B:

Lineage for d4andb_ (4and B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (10 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [234075] (3 PDB entries)

8. Domain d4andb_: 4and B: [239973]
   automated match to d4anca_
   mutant

Details for d4andb_

PDB Entry: 4and, 2.81 Å

PDB Description: crystal form ii of the d93n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4andb_:

Sequence, based on SEQRES records:

>d4andb_ d.58.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtraiaavrqlaggtnpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

Sequence, based on observed residues (ATOM records):

>d4andb_ d.58.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaeffgsllefi
tsgpvvaaivegtraiaavrqlaggtnpvqaaapgtirgdfaletqfnlvhgsdsaesaq
reialwfpga

Timeline for d4andb_:

• d4andb_ first appeared in SCOPe 2.04
  
• d4andb_ appears in SCOPe 2.06
  
• d4andb_ appears in the current release, SCOPe 2.08