Lineage for d4airb_ (4air B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140136Species Leishmania major [TaxId:5664] [234069] (1 PDB entry)
  8. 2140138Domain d4airb_: 4air B: [239971]
    automated match to d4aira_
    complexed with cl, fga

Details for d4airb_

PDB Entry: 4air (more details), 1.8 Å

PDB Description: Leishmania major cysteine synthase
PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d4airb_:

Sequence, based on SEQRES records: (download)

>d4airb_ c.79.1.0 (B:) automated matches {Leishmania major [TaxId: 5664]}
pfdksrnvaqsidqligqtpalylnklnntkakvvlkmecenpmasvkdrlgfaiydkae
kegklipgksvvvesssgntgvslahlgairgykviitmpesmslerrcllrifgaevil
tpaalgmkgavtmakkivtanpnavladqfatkynaliheettgpeiweqtnhnvdcfia
gvgtggtltgvaralkkmgsharivavepmespvlsggkpgahkiqgigpgfvpdvldrs
lidevfcvagddaietalkltrsdgvfcgfsgganvyaalkiaerpemegktivtiipsf
gerylstalyrsvrdevsslpvvdaselqd

Sequence, based on observed residues (ATOM records): (download)

>d4airb_ c.79.1.0 (B:) automated matches {Leishmania major [TaxId: 5664]}
pfdksrnvaqsidqligqtpalylnklnntkakvvlkmecenpmasvkdrlgfaiydkae
kegklipgksvvvesssgntgvslahlgairgykviitmpesmslerrcllrifgaevil
tpaalgmkgavtmakkivtanpnavladqfatkynaliheettgpeiweqtnhnvdcfia
gvgtggtltgvaralkkmgsharivavepmedrslidevfcvagddaietalkltrsdgv
fcgfsgganvyaalkiaerpemegktivtiipsfgerylstalyrsvrdevsslpvvdas
elqd

SCOPe Domain Coordinates for d4airb_:

Click to download the PDB-style file with coordinates for d4airb_.
(The format of our PDB-style files is described here.)

Timeline for d4airb_: