SCOPe 2.07: Domain d4adbd_: 4adb D:

Lineage for d4adbd_ (4adb D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Escherichia coli [TaxId:511693] [234051] (4 PDB entries)

8. Domain d4adbd_: 4adb D: [239967]
   automated match to d4adba_
   complexed with mg, na, plp

Details for d4adbd_

PDB Entry: 4adb, 2.2 Å

PDB Description: Structural and functional study of succinyl-ornithine transaminase from E. coli

PDB Compounds: (D:) succinylornithine transaminase

SCOPe Domain Sequences for d4adbd_:

Sequence; same for both SEQRES and ATOM records:

>d4adbd_ c.67.1.0 (D:) automated matches {Escherichia coli [TaxId: 511693]}
qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
vmvliaggnvvrfapalnvseeevttgldrfaaacehfvs

Timeline for d4adbd_:

• d4adbd_ first appeared in SCOPe 2.04
  
• d4adbd_ appears in SCOPe 2.06
  
• d4adbd_ appears in the current release, SCOPe 2.08