Lineage for d4a6tc_ (4a6t C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896940Species Chromobacterium violaceum [TaxId:536] [234042] (8 PDB entries)
  8. 2896955Domain d4a6tc_: 4a6t C: [239966]
    automated match to d4a6tb_
    complexed with plp

Details for d4a6tc_

PDB Entry: 4a6t (more details), 1.8 Å

PDB Description: crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp
PDB Compounds: (C:) omega transaminase

SCOPe Domain Sequences for d4a6tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6tc_ c.67.1.0 (C:) automated matches {Chromobacterium violaceum [TaxId: 536]}
rttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglwcvnv
gygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsgsesv
dtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgmahie
qpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppatywpe
iericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigavfvgk
rvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrwretf
srfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgdhivs
applvmtraevdemlavaercleefeqtlkargla

SCOPe Domain Coordinates for d4a6tc_:

Click to download the PDB-style file with coordinates for d4a6tc_.
(The format of our PDB-style files is described here.)

Timeline for d4a6tc_: