SCOPe 2.07: Domain d3zp1f_: 3zp1 F:

Lineage for d3zp1f_ (3zp1 F:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (36 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)

8. Domain d3zp1f_: 3zp1 F: [239962]
   Other proteins in same PDB: d3zp1e_
   automated match to d2fk0b1

Details for d3zp1f_

PDB Entry: 3zp1, 2.6 Å

PDB Description: influenza virus (vn1194) h5 ha with lstc

PDB Compounds: (F:) Haemagglutinin

SCOPe Domain Sequences for d3zp1f_:

Sequence; same for both SEQRES and ATOM records:

>d3zp1f_ h.3.1.1 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtyd

Timeline for d3zp1f_:

• d3zp1f_ first appeared in SCOPe 2.04
  
• d3zp1f_ appears in SCOPe 2.06
  
• d3zp1f_ appears in the current release, SCOPe 2.08