Lineage for d1qdod_ (1qdo D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663175Protein Concanavalin A [49901] (2 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 663181Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (50 PDB entries)
  8. 663246Domain d1qdod_: 1qdo D: [23996]
    complexed with ca, man, mma, mn

Details for d1qdod_

PDB Entry: 1qdo (more details), 2.8 Å

PDB Description: man(aplha1-3)man(alpha1-o)methyl concanavalin a complex
PDB Compounds: (D:) protein (concanavalin a)

SCOP Domain Sequences for d1qdod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qdod_ b.29.1.1 (D:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1qdod_:

Click to download the PDB-style file with coordinates for d1qdod_.
(The format of our PDB-style files is described here.)

Timeline for d1qdod_: