| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (36 species) not a true protein |
| Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [256161] (12 PDB entries) |
| Domain d3znlf_: 3znl F: [239958] Other proteins in same PDB: d3znla_, d3znlc_, d3znle_ automated match to d2fk0b1 complexed with epe, nag |
PDB Entry: 3znl (more details), 2.5 Å
SCOPe Domain Sequences for d3znlf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3znlf_ h.3.1.1 (F:) automated matches {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqys
Timeline for d3znlf_: