SCOPe 2.05: Domain d3znkd_: 3znk D:

Lineage for d3znkd_ (3znk D:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus [TaxId:644788] [256161] (3 PDB entries)

8. Domain d3znkd_: 3znk D: [239954]
   Other proteins in same PDB: d3znka_, d3znkc_, d3znke_
   automated match to d2fk0b1
   complexed with epe, nag

Details for d3znkd_

PDB Entry: 3znk, 2.71 Å

PDB Description: h5 haemagglutinin in complex with 6-o-sulfo-2,3-sialyllactosamine (sulfated 3'sln)

PDB Compounds: (D:) Haemagglutinin

SCOPe Domain Sequences for d3znkd_:

Sequence; same for both SEQRES and ATOM records:

>d3znkd_ h.3.1.1 (D:) automated matches {Influenza a virus [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqys

Timeline for d3znkd_:

• d3znkd_ first appeared in SCOPe 2.04
  
• d3znkd_ appears in SCOPe 2.06
  
• d3znkd_ appears in the current release, SCOPe 2.08