Lineage for d3znkb_ (3znk B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970204Species Influenza a virus [TaxId:644788] [256161] (3 PDB entries)
  8. 1970211Domain d3znkb_: 3znk B: [239953]
    Other proteins in same PDB: d3znka_, d3znkc_, d3znke_
    automated match to d2fk0b1
    complexed with epe, nag

Details for d3znkb_

PDB Entry: 3znk (more details), 2.71 Å

PDB Description: h5 haemagglutinin in complex with 6-o-sulfo-2,3-sialyllactosamine (sulfated 3'sln)
PDB Compounds: (B:) Haemagglutinin

SCOPe Domain Sequences for d3znkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znkb_ h.3.1.1 (B:) automated matches {Influenza a virus [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqys

SCOPe Domain Coordinates for d3znkb_:

Click to download the PDB-style file with coordinates for d3znkb_.
(The format of our PDB-style files is described here.)

Timeline for d3znkb_: