SCOP 1.75: Domain d1qdoc_: 1qdo C:

Lineage for d1qdoc_ (1qdo C:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Concanavalin A [49901] (2 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (52 PDB entries)
   Uniprot P81461

8. Domain d1qdoc_: 1qdo C: [23995]

Details for d1qdoc_

PDB Entry: 1qdo, 2.8 Å

PDB Description: man(aplha1-3)man(alpha1-o)methyl concanavalin a complex

PDB Compounds: (C:) protein (concanavalin a)

SCOP Domain Sequences for d1qdoc_:

Sequence; same for both SEQRES and ATOM records:

>d1qdoc_ b.29.1.1 (C:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1qdoc_:

• d1qdoc_ first appeared (with stable ids) in SCOP 1.55
  
• d1qdoc_ appears in SCOP 1.73
  
• d1qdoc_ appears in SCOPe 2.01
  
• d1qdoc_ appears in the current release, SCOPe 2.08