Lineage for d3zlhc1 (3zlh C:1-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948580Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries)
  8. 2948591Domain d3zlhc1: 3zlh C:1-139 [239949]
    Other proteins in same PDB: d3zlha2, d3zlha3, d3zlhb2, d3zlhb3, d3zlhc2, d3zlhc3, d3zlhd2, d3zlhd3
    automated match to d3zlhb1

Details for d3zlhc1

PDB Entry: 3zlh (more details), 2.9 Å

PDB Description: structure of group a streptococcal enolase
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d3zlhc1:

Sequence, based on SEQRES records: (download)

>d3zlhc1 d.54.1.0 (C:1-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
glgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavar
aaadylevplytylggfnt

Sequence, based on observed residues (ATOM records): (download)

>d3zlhc1 d.54.1.0 (C:1-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgavelrdgdksrylglgtqka
vdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraaadyle
vplytylggfnt

SCOPe Domain Coordinates for d3zlhc1:

Click to download the PDB-style file with coordinates for d3zlhc1.
(The format of our PDB-style files is described here.)

Timeline for d3zlhc1: