SCOPe 2.04: Domain d3zlfd2: 3zlf D:140-433

Lineage for d3zlfd2 (3zlf D:140-433)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:286636] [236667] (3 PDB entries)

8. Domain d3zlfd2: 3zlf D:140-433 [239944]
   Other proteins in same PDB: d3zlfa1, d3zlfb1, d3zlfc1, d3zlfd1
   automated match to d3zlfb2
   complexed with po4; mutant

Details for d3zlfd2

PDB Entry: 3zlf, 2.15 Å

PDB Description: structure of group a streptococcal enolase k312a mutant

PDB Compounds: (D:) enolase

SCOPe Domain Sequences for d3zlfd2:

Sequence; same for both SEQRES and ATOM records:

>d3zlfd2 c.1.11.0 (D:140-433) automated matches {Streptococcus pyogenes [TaxId: 286636]}
kvlptpmmniinggshsdapiafqefmimpvgaptfkeglrwgaevfhalkkilkerglv
tavgdeggfapkfegtedgvetilkaieaagyeagengimigfdcassefydkerkvydy
tkfegegaavrtsaeqvdyleelvnkypiitiedgmdendwdgwkvlterlgarvqlvgd
dffvtnteylargikenaansilikvnqigtltetfeaiemakeagytavvshrsgeted
stiadiavatnagqiktgslsrtdriakynqllriedqlgevaqykgiksfynl

Timeline for d3zlfd2:

• d3zlfd2 is new in SCOPe 2.04-stable
  
• d3zlfd2 appears in SCOPe 2.05
  
• d3zlfd2 appears in the current release, SCOPe 2.08