Lineage for d3zian3 (3zia N:358-475)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1494900Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1494901Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1495029Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 1495030Protein automated matches [254528] (6 species)
    not a true protein
  7. 1495038Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries)
  8. 1495042Domain d3zian3: 3zia N:358-475 [239936]
    Other proteins in same PDB: d3ziad1, d3ziad2, d3ziae1, d3ziae2, d3ziaf1, d3ziaf2, d3ziag_, d3zian1, d3zian2, d3ziao1, d3ziao2, d3ziap1, d3ziap2, d3ziaq_
    automated match to d2jdid1
    complexed with adp, atp, edo, mg

Details for d3zian3

PDB Entry: 3zia (more details), 2.5 Å

PDB Description: the structure of f1-atpase from saccharomyces cerevisiae inhibited by its regulatory protein if1
PDB Compounds: (N:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d3zian3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zian3 a.69.1.0 (N:358-475) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

SCOPe Domain Coordinates for d3zian3:

Click to download the PDB-style file with coordinates for d3zian3.
(The format of our PDB-style files is described here.)

Timeline for d3zian3: