![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310897] (6 PDB entries) |
![]() | Domain d3ziaf2: 3zia F:83-357 [239932] Other proteins in same PDB: d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad3, d3ziae1, d3ziae3, d3ziaf1, d3ziaf3, d3ziag_, d3ziah1, d3ziah2, d3ziai_, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian3, d3ziao1, d3ziao3, d3ziap1, d3ziap3, d3ziaq_, d3ziar1, d3ziar2, d3zias_ automated match to d2jdid3 complexed with adp, atp, edo, mg |
PDB Entry: 3zia (more details), 2.5 Å
SCOPe Domain Sequences for d3ziaf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ziaf2 c.37.1.11 (F:83-357) Central domain of beta subunit of F1 ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap attfahldattvlsrgiselgiypavdpldsksrl
Timeline for d3ziaf2:
![]() Domains from other chains: (mouse over for more information) d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziag_, d3ziah1, d3ziah2, d3ziai_, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3, d3ziaq_, d3ziar1, d3ziar2, d3zias_ |