Lineage for d3ziae1 (3zia E:8-82)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1547881Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1547882Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1548010Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 1548011Protein automated matches [254527] (6 species)
    not a true protein
  7. 1548019Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries)
  8. 1548021Domain d3ziae1: 3zia E:8-82 [239928]
    Other proteins in same PDB: d3ziad2, d3ziad3, d3ziae2, d3ziae3, d3ziaf2, d3ziaf3, d3ziag_, d3zian2, d3zian3, d3ziao2, d3ziao3, d3ziap2, d3ziap3, d3ziaq_
    automated match to d2jdid2
    complexed with adp, atp, edo, mg

Details for d3ziae1

PDB Entry: 3zia (more details), 2.5 Å

PDB Description: the structure of f1-atpase from saccharomyces cerevisiae inhibited by its regulatory protein if1
PDB Compounds: (E:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d3ziae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ziae1 b.49.1.0 (E:8-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
eglvrgekvldtggp

SCOPe Domain Coordinates for d3ziae1:

Click to download the PDB-style file with coordinates for d3ziae1.
(The format of our PDB-style files is described here.)

Timeline for d3ziae1: