Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries) |
Domain d3ziae1: 3zia E:8-82 [239928] Other proteins in same PDB: d3ziad2, d3ziad3, d3ziae2, d3ziae3, d3ziaf2, d3ziaf3, d3ziag_, d3zian2, d3zian3, d3ziao2, d3ziao3, d3ziap2, d3ziap3, d3ziaq_ automated match to d2jdid2 complexed with adp, atp, edo, mg |
PDB Entry: 3zia (more details), 2.5 Å
SCOPe Domain Sequences for d3ziae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ziae1 b.49.1.0 (E:8-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt eglvrgekvldtggp
Timeline for d3ziae1: