SCOPe 2.08: Domain d3ziae1: 3zia E:8-82

Lineage for d3ziae1 (3zia E:8-82)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries)

8. Domain d3ziae1: 3zia E:8-82 [239928]
   Other proteins in same PDB: d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad2, d3ziad3, d3ziae2, d3ziae3, d3ziaf2, d3ziaf3, d3ziag_, d3ziah1, d3ziah2, d3ziai_, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian2, d3zian3, d3ziao2, d3ziao3, d3ziap2, d3ziap3, d3ziaq_, d3ziar1, d3ziar2, d3zias_
   automated match to d2jdid2
   complexed with adp, atp, edo, mg

Details for d3ziae1

PDB Entry: 3zia, 2.5 Å

PDB Description: the structure of f1-atpase from saccharomyces cerevisiae inhibited by its regulatory protein if1

PDB Compounds: (E:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d3ziae1:

Sequence; same for both SEQRES and ATOM records:

>d3ziae1 b.49.1.1 (E:8-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
eglvrgekvldtggp

Timeline for d3ziae1:

• d3ziae1 first appeared in SCOPe 2.04
  
• d3ziae1 appears in SCOPe 2.07