Lineage for d3ziad3 (3zia D:358-475)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717381Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2717384Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries)
  8. 2717421Domain d3ziad3: 3zia D:358-475 [239927]
    Other proteins in same PDB: d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad2, d3ziae1, d3ziae2, d3ziaf1, d3ziaf2, d3ziag_, d3ziah1, d3ziah2, d3ziai_, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian2, d3ziao1, d3ziao2, d3ziap1, d3ziap2, d3ziaq_, d3ziar1, d3ziar2, d3zias_
    automated match to d2jdid1
    complexed with adp, atp, edo, mg

Details for d3ziad3

PDB Entry: 3zia (more details), 2.5 Å

PDB Description: the structure of f1-atpase from saccharomyces cerevisiae inhibited by its regulatory protein if1
PDB Compounds: (D:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d3ziad3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ziad3 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

SCOPe Domain Coordinates for d3ziad3:

Click to download the PDB-style file with coordinates for d3ziad3.
(The format of our PDB-style files is described here.)

Timeline for d3ziad3: