Lineage for d3ziad2 (3zia D:83-357)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847928Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1848393Protein automated matches [190393] (10 species)
    not a true protein
  7. 1848398Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255213] (6 PDB entries)
  8. 1848399Domain d3ziad2: 3zia D:83-357 [239926]
    Other proteins in same PDB: d3ziad1, d3ziad3, d3ziae1, d3ziae3, d3ziaf1, d3ziaf3, d3ziag_, d3zian1, d3zian3, d3ziao1, d3ziao3, d3ziap1, d3ziap3, d3ziaq_
    automated match to d2jdid3
    complexed with adp, atp, edo, mg

Details for d3ziad2

PDB Entry: 3zia (more details), 2.5 Å

PDB Description: the structure of f1-atpase from saccharomyces cerevisiae inhibited by its regulatory protein if1
PDB Compounds: (D:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d3ziad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ziad2 c.37.1.11 (D:83-357) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd
llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk
etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft
qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap
attfahldattvlsrgiselgiypavdpldsksrl

SCOPe Domain Coordinates for d3ziad2:

Click to download the PDB-style file with coordinates for d3ziad2.
(The format of our PDB-style files is described here.)

Timeline for d3ziad2: