Lineage for d3wjfb_ (3wjf B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805542Family b.60.1.8: Rv2717c-like [141475] (3 proteins)
    bacterial and plant proteins with a fatty acid binding protein-like fold
    automatically mapped to Pfam PF08768
  6. 2805555Protein automated matches [238328] (1 species)
    not a true protein
  7. 2805556Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [238329] (6 PDB entries)
  8. 2805562Domain d3wjfb_: 3wjf B: [239918]
    automated match to d3wjfa_
    mutant

Details for d3wjfb_

PDB Entry: 3wjf (more details), 2.2 Å

PDB Description: crystal structure of mutant nitrobindin m75l/h76l/q96c/v128w/m148l/h158l (nb9) from arabidopsis thaliana
PDB Compounds: (B:) UPF0678 fatty acid-binding protein-like protein At1g79260

SCOPe Domain Sequences for d3wjfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wjfb_ b.60.1.8 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
pllaesgyfrprpdgsievviacstglvevqkgtynvdeqsiklksdlvgnaskwkeisr
efelvdgklsyvvrlstttnplqpllkaildkl

SCOPe Domain Coordinates for d3wjfb_:

Click to download the PDB-style file with coordinates for d3wjfb_.
(The format of our PDB-style files is described here.)

Timeline for d3wjfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3wjfa_