Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.8: Rv2717c-like [141475] (3 proteins) bacterial and plant proteins with a fatty acid binding protein-like fold automatically mapped to Pfam PF08768 |
Protein automated matches [238328] (1 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [238329] (6 PDB entries) |
Domain d3wjfb_: 3wjf B: [239918] automated match to d3wjfa_ mutant |
PDB Entry: 3wjf (more details), 2.2 Å
SCOPe Domain Sequences for d3wjfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wjfb_ b.60.1.8 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga pllaesgyfrprpdgsievviacstglvevqkgtynvdeqsiklksdlvgnaskwkeisr efelvdgklsyvvrlstttnplqpllkaildkl
Timeline for d3wjfb_: