Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Camponotus japonicus [TaxId:84547] [236657] (2 PDB entries) |
Domain d3weaa_: 3wea A: [239915] automated match to d3weab_ |
PDB Entry: 3wea (more details), 1.8 Å
SCOPe Domain Sequences for d3weaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3weaa_ b.1.18.0 (A:) automated matches {Camponotus japonicus [TaxId: 84547]} fvfedcgsevgkfsdiiisscdpseekcsiireseihvsmkftpsvdvknveakafgvll dvpvpfplkkpeickdpdsgvkcplkkdveieykvtffvekatpalsleimwefrnekde kitcvkfpakik
Timeline for d3weaa_: