Lineage for d3wdpr_ (3wdp R:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1819528Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. 1819683Protein automated matches [190245] (10 species)
    not a true protein
  7. 1819694Species Pyrococcus furiosus [TaxId:2261] [189762] (2 PDB entries)
  8. 1819697Domain d3wdpr_: 3wdp R: [239913]
    automated match to d3wdpq_
    complexed with gol, po4; mutant

Details for d3wdpr_

PDB Entry: 3wdp (more details), 1.7 Å

PDB Description: Structural analysis of a beta-glucosidase mutant derived from a hyperthermophilic tetrameric structure
PDB Compounds: (R:) Beta-glucosidase

SCOPe Domain Sequences for d3wdpr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wdpr_ c.1.8.4 (R:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
akfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhl
ykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikelek
ianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdaapagwldekt
vvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlasgfppgflsfeaaekakfnl
iqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkld
wigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyl
nnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaq
gfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtrk

SCOPe Domain Coordinates for d3wdpr_:

Click to download the PDB-style file with coordinates for d3wdpr_.
(The format of our PDB-style files is described here.)

Timeline for d3wdpr_: