SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1bxhc_ (1bxh C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042202Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2042222Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (57 PDB entries)
    Uniprot P81461
  8. 2042313Domain d1bxhc_: 1bxh C: [23991]
    complexed with ca, mma, mn

Details for d1bxhc_

PDB Entry: 1bxh (more details), 2.75 Å

PDB Description: concanavalin a complexed to methyl alpha1-2 mannobioside
PDB Compounds: (C:) protein (concanavalin a)

SCOPe Domain Sequences for d1bxhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxhc_ b.29.1.1 (C:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d1bxhc_:

Click to download the PDB-style file with coordinates for d1bxhc_.
(The format of our PDB-style files is described here.)

Timeline for d1bxhc_: