| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) ![]() |
| Family a.5.3.0: automated matches [227224] (1 protein) not a true family |
| Protein automated matches [226965] (4 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [233924] (2 PDB entries) |
| Domain d3w67d1: 3w67 D:25-90 [239903] Other proteins in same PDB: d3w67a2, d3w67b2, d3w67c2, d3w67d2 automated match to d3w67a1 complexed with 3pt, viv |
PDB Entry: 3w67 (more details), 2.61 Å
SCOPe Domain Sequences for d3w67d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w67d1 a.5.3.0 (D:25-90) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpglaelrrrvqeagvpqtpqpltdafllrflrardfdldlawrlmknyykwraecpels
adlrpr
Timeline for d3w67d1: