SCOPe 2.04: Domain d3w67c1: 3w67 C:26-90

Lineage for d3w67c1 (3w67 C:26-90)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families)

5. Family a.5.3.0: automated matches [227224] (1 protein)
   not a true family

6. Protein automated matches [226965] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [233924] (2 PDB entries)

8. Domain d3w67c1: 3w67 C:26-90 [239901]
   Other proteins in same PDB: d3w67a2, d3w67b2, d3w67c2, d3w67d2
   automated match to d3w67a1
   complexed with 3pt, viv

Details for d3w67c1

PDB Entry: 3w67, 2.61 Å

PDB Description: Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(3,4)-bisphosphate

PDB Compounds: (C:) alpha-tocopherol transfer protein

SCOPe Domain Sequences for d3w67c1:

Sequence; same for both SEQRES and ATOM records:

>d3w67c1 a.5.3.0 (C:26-90) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pglaelrrrvqeagvpqtpqpltdafllrflrardfdldlawrlmknyykwraecpelsa
dlrpr

Timeline for d3w67c1:

• d3w67c1 is new in SCOPe 2.04-stable
  
• d3w67c1 appears in SCOPe 2.05
  
• d3w67c1 appears in the current release, SCOPe 2.08