Lineage for d3w67b1 (3w67 B:23-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696232Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 2696251Family a.5.3.0: automated matches [227224] (1 protein)
    not a true family
  6. 2696252Protein automated matches [226965] (4 species)
    not a true protein
  7. 2696271Species Mouse (Mus musculus) [TaxId:10090] [233924] (2 PDB entries)
  8. 2696277Domain d3w67b1: 3w67 B:23-90 [239899]
    Other proteins in same PDB: d3w67a2, d3w67b2, d3w67c2, d3w67d2
    automated match to d3w68b1
    complexed with 3pt, viv

Details for d3w67b1

PDB Entry: 3w67 (more details), 2.61 Å

PDB Description: Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(3,4)-bisphosphate
PDB Compounds: (B:) alpha-tocopherol transfer protein

SCOPe Domain Sequences for d3w67b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w67b1 a.5.3.0 (B:23-90) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
llqpglaelrrrvqeagvpqtpqpltdafllrflrardfdldlawrlmknyykwraecpe
lsadlrpr

SCOPe Domain Coordinates for d3w67b1:

Click to download the PDB-style file with coordinates for d3w67b1.
(The format of our PDB-style files is described here.)

Timeline for d3w67b1: