SCOPe 2.04: Domain d3w18a_: 3w18 A:

Lineage for d3w18a_ (3w18 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
   OPK group; AIRK subfamily; serine/threonine kinase
7. Species Human (Homo sapiens) [TaxId:9606] [90039] (43 PDB entries)

8. Domain d3w18a_: 3w18 A: [239898]
   automated match to d3w18b_
   complexed with n13

Details for d3w18a_

PDB Entry: 3w18, 2.5 Å

PDB Description: Structure of Aurora kinase A complexed to benzoimidazole-indazole inhibitor XIII

PDB Compounds: (A:) Aurora kinase A

SCOPe Domain Sequences for d3w18a_:

Sequence, based on SEQRES records:

>d3w18a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanss

Sequence, based on observed residues (ATOM records):

>d3w18a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgknvylarekqskfilalkvlfkaqlekareveiqshlrhpnil
rlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychskrvih
rdikpenlllgsagelkiagtldylppemiegdekvdlwslgvlcyeflvgkppfeanty
qetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitanss

Timeline for d3w18a_:

• d3w18a_ is new in SCOPe 2.04-stable
  
• d3w18a_ appears in SCOPe 2.05
  
• d3w18a_ appears in the current release, SCOPe 2.08