Lineage for d3w18a_ (3w18 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [90039] (43 PDB entries)
  8. 1671962Domain d3w18a_: 3w18 A: [239898]
    automated match to d3w18b_
    complexed with n13

Details for d3w18a_

PDB Entry: 3w18 (more details), 2.5 Å

PDB Description: Structure of Aurora kinase A complexed to benzoimidazole-indazole inhibitor XIII
PDB Compounds: (A:) Aurora kinase A

SCOPe Domain Sequences for d3w18a_:

Sequence, based on SEQRES records: (download)

>d3w18a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanss

Sequence, based on observed residues (ATOM records): (download)

>d3w18a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgknvylarekqskfilalkvlfkaqlekareveiqshlrhpnil
rlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychskrvih
rdikpenlllgsagelkiagtldylppemiegdekvdlwslgvlcyeflvgkppfeanty
qetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitanss

SCOPe Domain Coordinates for d3w18a_:

Click to download the PDB-style file with coordinates for d3w18a_.
(The format of our PDB-style files is described here.)

Timeline for d3w18a_: