Lineage for d3v62b2 (3v62 B:127-255)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2215978Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2216140Protein automated matches [227006] (4 species)
    not a true protein
  7. 2216155Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233826] (5 PDB entries)
  8. 2216159Domain d3v62b2: 3v62 B:127-255 [239889]
    Other proteins in same PDB: d3v62a_, d3v62d_
    automated match to d3v60b2
    protein/DNA complex; complexed with neq, so4

Details for d3v62b2

PDB Entry: 3v62 (more details), 2.9 Å

PDB Description: structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3v62b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v62b2 d.131.1.2 (B:127-255) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfn

SCOPe Domain Coordinates for d3v62b2:

Click to download the PDB-style file with coordinates for d3v62b2.
(The format of our PDB-style files is described here.)

Timeline for d3v62b2: