Lineage for d3v5wa2 (3v5w A:186-549)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (682 PDB entries)
  8. 2545407Domain d3v5wa2: 3v5w A:186-549 [239886]
    Other proteins in same PDB: d3v5wa1, d3v5wa3, d3v5wb_, d3v5wg_
    automated match to d1omwa3
    complexed with 8pr, mg

Details for d3v5wa2

PDB Entry: 3v5w (more details), 2.07 Å

PDB Description: Human G Protein-Coupled Receptor Kinase 2 in Complex with Soluble Gbetagamma Subunits and Paroxetine
PDB Compounds: (A:) g-protein coupled receptor kinase 2

SCOPe Domain Sequences for d3v5wa2:

Sequence, based on SEQRES records: (download)

>d3v5wa2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknk
qlgh

Sequence, based on observed residues (ATOM records): (download)

>d3v5wa2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdk
giklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknkqlgh

SCOPe Domain Coordinates for d3v5wa2:

Click to download the PDB-style file with coordinates for d3v5wa2.
(The format of our PDB-style files is described here.)

Timeline for d3v5wa2: