SCOPe 2.06: Domain d3uxld1: 3uxl D:3-132

Lineage for d3uxld1 (3uxl D:3-132)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [228629] (6 PDB entries)

8. Domain d3uxld1: 3uxl D:3-132 [239882]
   Other proteins in same PDB: d3uxlc2, d3uxld2
   automated match to d3uxkd1
   complexed with cfi, mg

Details for d3uxld1

PDB Entry: 3uxl, 2.2 Å

PDB Description: P. putida mandelate racemase co-crystallized with the intermediate analogue cupferron

PDB Compounds: (D:) mandelate racemase

SCOPe Domain Sequences for d3uxld1:

Sequence; same for both SEQRES and ATOM records:

>d3uxld1 d.54.1.0 (D:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

Timeline for d3uxld1:

• d3uxld1 first appeared in SCOPe 2.04
  
• d3uxld1 appears in SCOPe 2.05
  
• d3uxld1 appears in SCOPe 2.07
  
• d3uxld1 appears in the current release, SCOPe 2.08