Lineage for d3uwoa_ (3uwo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114605Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (11 PDB entries)
  8. 2114608Domain d3uwoa_: 3uwo A: [239879]
    automated match to d3uwob_
    complexed with 0dj

Details for d3uwoa_

PDB Entry: 3uwo (more details), 1.7 Å

PDB Description: Structure Guided Development of Novel Thymidine Mimetics targeting Pseudomonas aeruginosa Thymidylate Kinase: from Hit to Lead Generation
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d3uwoa_:

Sequence, based on SEQRES records: (download)

>d3uwoa_ c.37.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
vqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqaperyq
vldaglplaevqagldrllpnller

Sequence, based on observed residues (ATOM records): (download)

>d3uwoa_ c.37.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
vqgdlrpdltlvfdlpvrldrfeqedrrffeavrqtylqraaqaperyqvldaglplaev
qagldrllpnller

SCOPe Domain Coordinates for d3uwoa_:

Click to download the PDB-style file with coordinates for d3uwoa_.
(The format of our PDB-style files is described here.)

Timeline for d3uwoa_: