Lineage for d3usct_ (3usc T:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624800Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2624801Protein automated matches [191172] (11 species)
    not a true protein
  7. 2624833Species Escherichia coli [TaxId:562] [256126] (6 PDB entries)
  8. 2624845Domain d3usct_: 3usc T: [239876]
    Other proteins in same PDB: d3uscl_, d3uscm_
    automated match to d3ayxb_
    complexed with 3ni, cl, f3s, fco, li, lmt, mg, sf3, sf4, so4

Details for d3usct_

PDB Entry: 3usc (more details), 2 Å

PDB Description: Crystal Structure of E. coli hydrogenase-1 in a ferricyanide-oxidized form
PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d3usct_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3usct_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 562]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrvv

SCOPe Domain Coordinates for d3usct_:

Click to download the PDB-style file with coordinates for d3usct_.
(The format of our PDB-style files is described here.)

Timeline for d3usct_: