![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
![]() | Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) ![]() |
![]() | Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
![]() | Protein automated matches [191172] (7 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [256126] (5 PDB entries) |
![]() | Domain d3usct_: 3usc T: [239876] Other proteins in same PDB: d3uscl_, d3uscm_ automated match to d3ayxb_ complexed with 3ni, cl, f3s, fco, li, lmt, mg, sf3, sf4, so4 |
PDB Entry: 3usc (more details), 2 Å
SCOPe Domain Sequences for d3usct_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3usct_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 562]} kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi qsghgclgcaengfwdrgsfysrvv
Timeline for d3usct_: