SCOPe 2.08: Domain d3ul3a_: 3ul3 A:

Lineage for d3ul3a_ (3ul3 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [228276] (25 PDB entries)

8. Domain d3ul3a_: 3ul3 A: [239870]
   automated match to d3ul3b_

Details for d3ul3a_

PDB Entry: 3ul3, 2.91 Å

PDB Description: structural insights into thioredoxin-2: a component of malaria parasite protein secretion machinery

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d3ul3a_:

Sequence; same for both SEQRES and ATOM records:

>d3ul3a_ c.47.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
rlqqngsniingvnmkntvivlyffakwcqactmqstemdklqkyygkriyllkvdldkn
eslarkfsvkslptiillknktmlarkdhfvssndlialikkh

Timeline for d3ul3a_:

• d3ul3a_ first appeared in SCOPe 2.04
  
• d3ul3a_ appears in SCOPe 2.07