| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (29 species) not a true protein |
| Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries) |
| Domain d3ubqj_: 3ubq J: [239868] Other proteins in same PDB: d3ubqa_, d3ubqc_, d3ubqe1, d3ubqe2, d3ubqg_, d3ubqi_, d3ubqk_ automated match to d4n5zb_ complexed with nag |
PDB Entry: 3ubq (more details), 2 Å
SCOPe Domain Sequences for d3ubqj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubqj_ h.3.1.1 (J:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
Timeline for d3ubqj_: