Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries) |
Domain d3ubqd_: 3ubq D: [239865] Other proteins in same PDB: d3ubqa_, d3ubqc_, d3ubqe_, d3ubqg_, d3ubqi_, d3ubqk_ automated match to d4n5zb_ complexed with nag |
PDB Entry: 3ubq (more details), 2 Å
SCOPe Domain Sequences for d3ubqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubqd_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 641501]} glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
Timeline for d3ubqd_: