Lineage for d1teih_ (1tei H:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794082Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 794086Protein Concanavalin A [49901] (2 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 794092Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (52 PDB entries)
    Uniprot P81461
  8. 794164Domain d1teih_: 1tei H: [23986]
    complexed with ca, man, mn, nag

Details for d1teih_

PDB Entry: 1tei (more details), 2.7 Å

PDB Description: structure of concanavalin a complexed to beta-d-glcnac (1,2)alpha-d- man-(1,6)[beta-d-glcnac(1,2)alpha-d-man (1,6)]alpha-d-man
PDB Compounds: (H:) concanavalin a

SCOP Domain Sequences for d1teih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teih_ b.29.1.1 (H:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d1teih_:

Click to download the PDB-style file with coordinates for d1teih_.
(The format of our PDB-style files is described here.)

Timeline for d1teih_: