SCOPe 2.04: Domain d3ubjl_: 3ubj L:

Lineage for d3ubjl_ (3ubj L:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (27 species)
   not a true protein

7. Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)

8. Domain d3ubjl_: 3ubj L: [239857]
   Other proteins in same PDB: d3ubja_, d3ubjc_, d3ubje_, d3ubjg_, d3ubji_, d3ubjk_
   automated match to d4n5zb_
   complexed with nag

Details for d3ubjl_

PDB Entry: 3ubj, 2.25 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand lsta

PDB Compounds: (L:) hemagglutinin HA2

SCOPe Domain Sequences for d3ubjl_:

Sequence; same for both SEQRES and ATOM records:

>d3ubjl_ h.3.1.1 (L:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeakln

Timeline for d3ubjl_:

• d3ubjl_ is new in SCOPe 2.04-stable
  
• d3ubjl_ appears in SCOPe 2.05
  
• d3ubjl_ appears in the current release, SCOPe 2.08