SCOPe 2.04: Domain d3ubeh_: 3ube H:

Lineage for d3ubeh_ (3ube H:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (27 species)
   not a true protein

7. Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)

8. Domain d3ubeh_: 3ube H: [239849]
   Other proteins in same PDB: d3ubea_, d3ubec_, d3ubee_, d3ubeg_, d3ubei_, d3ubek_
   automated match to d4n5zb_
   complexed with nag, sia

Details for d3ubeh_

PDB Entry: 3ube, 2.15 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand lstc

PDB Compounds: (H:) hemagglutinin HA2

SCOPe Domain Sequences for d3ubeh_:

Sequence; same for both SEQRES and ATOM records:

>d3ubeh_ h.3.1.1 (H:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr

Timeline for d3ubeh_:

• d3ubeh_ is new in SCOPe 2.04-stable
  
• d3ubeh_ appears in SCOPe 2.05
  
• d3ubeh_ appears in the current release, SCOPe 2.08