Lineage for d3ubed_ (3ube D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646178Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)
  8. 2646195Domain d3ubed_: 3ube D: [239847]
    Other proteins in same PDB: d3ubea_, d3ubec_, d3ubee_, d3ubeg_, d3ubei_, d3ubek1, d3ubek2
    automated match to d4n5zb_
    complexed with gal, nag, sia

Details for d3ubed_

PDB Entry: 3ube (more details), 2.15 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand lstc
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d3ubed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubed_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre

SCOPe Domain Coordinates for d3ubed_:

Click to download the PDB-style file with coordinates for d3ubed_.
(The format of our PDB-style files is described here.)

Timeline for d3ubed_: