Lineage for d3u4jd_ (3u4j D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141546Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [233768] (1 PDB entry)
  8. 2141550Domain d3u4jd_: 3u4j D: [239845]
    Other proteins in same PDB: d3u4ja2, d3u4jc2
    automated match to d3u4jb_
    complexed with ca

Details for d3u4jd_

PDB Entry: 3u4j (more details), 2 Å

PDB Description: Crystal structure of NAD-dependent aldehyde dehydrogenase from Sinorhizobium meliloti
PDB Compounds: (D:) NAD-dependent aldehyde dehydrogenase

SCOPe Domain Sequences for d3u4jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u4jd_ c.82.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
lsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasaddv
rkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqarge
igfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiaservp
waigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpnvdm
vaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhnagqc
cisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvtagi
tsgaelllggerigreaglyyaptvfagvtpdmsiareeifgpvlstltfktadeavala
natefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrelgry
gfdeysqfkgvhvtlgrpapwft

SCOPe Domain Coordinates for d3u4jd_:

Click to download the PDB-style file with coordinates for d3u4jd_.
(The format of our PDB-style files is described here.)

Timeline for d3u4jd_: