![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [233768] (1 PDB entry) |
![]() | Domain d3u4jc1: 3u4j C:1-504 [239844] Other proteins in same PDB: d3u4ja2, d3u4jc2 automated match to d3u4ja_ complexed with ca |
PDB Entry: 3u4j (more details), 2 Å
SCOPe Domain Sequences for d3u4jc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u4jc1 c.82.1.0 (C:1-504) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} mlsnfiapdsndprlriksryqmlvdgksvdaasgstidrvspghagevvgtwpeasadd vrkavaaarkafdagpwprmsgaersrlmfkvadlilarqeelalieslevgkpiaqarg eigfcadlwsyaagqaralegqthnnigddrlglvlrepvgvvgiitpwnfpfiiaserv pwaigsgctvvlkpseftsgtsirlaelareagipdgvfnvvtgygdpagqvlaedpnvd mvaftgsvrvgtklgeiaartvkrvglelggkgpqivfadadldaaadgiaygvyhnagq ccisgsrllvqegirdalmerlldisrkvafgdplnertkigamiseahaekvhsyvtag itsgaelllggerigreaglyyaptvfagvtpdmsiareeifgpvlstltfktadeaval anatefglsasvwstnletalqtirriragrcwinsvidgtpelpiggykksglgrelgr ygfdeysqfkgvhvtlgrpapwft
Timeline for d3u4jc1:
![]() Domains from other chains: (mouse over for more information) d3u4ja1, d3u4ja2, d3u4jb_, d3u4jd_ |