![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species uncultured organism [TaxId:155900] [233764] (1 PDB entry) |
![]() | Domain d3u3gd_: 3u3g D: [239843] automated match to d3u3ga_ complexed with cl, unl |
PDB Entry: 3u3g (more details), 1.4 Å
SCOPe Domain Sequences for d3u3gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u3gd_ c.55.3.0 (D:) automated matches {uncultured organism [TaxId: 155900]} mnkiiiytdggargnpgpagigvvitdekgntlhessayigettnnvaeyealiraledl qmfgdklvdmevevrmdselivrqmqgvykvkeptlkekfakiahikmervpnlvfvhip reknaradelvneaidkals
Timeline for d3u3gd_: