SCOPe 2.07: Domain d3tx7b_: 3tx7 B:

Lineage for d3tx7b_ (3tx7 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)

8. Domain d3tx7b_: 3tx7 B: [239838]
   Other proteins in same PDB: d3tx7a_
   automated match to d2xhsa_
   complexed with p6l

Details for d3tx7b_

PDB Entry: 3tx7, 2.76 Å

PDB Description: Crystal structure of LRH-1/beta-catenin complex

PDB Compounds: (B:) Nuclear receptor subfamily 5 group A member 2

SCOPe Domain Sequences for d3tx7b_:

Sequence, based on SEQRES records:

>d3tx7b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asiphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsive
warssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiias
qagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvn
aalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha

Sequence, based on observed residues (ATOM records):

>d3tx7b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asiphlilellkcepdepqvqakimaylqqeqaklstfglmckmadqtlfsivewarssq
mkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqagatlnnlmshaqel
vaklrslqfdqrefvclkflvlfsldvqlvegvqeqvnaalldytmcnypqqtekfgqll
lrlpeiraismqaeeylyykhlngdvpynnlliemlha

Timeline for d3tx7b_:

• d3tx7b_ first appeared in SCOPe 2.04
  
• d3tx7b_ appears in SCOPe 2.06
  
• d3tx7b_ appears in the current release, SCOPe 2.08