Lineage for d3tx7b_ (3tx7 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343025Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)
  8. 2343097Domain d3tx7b_: 3tx7 B: [239838]
    Other proteins in same PDB: d3tx7a_
    automated match to d2xhsa_
    complexed with p6l

Details for d3tx7b_

PDB Entry: 3tx7 (more details), 2.76 Å

PDB Description: Crystal structure of LRH-1/beta-catenin complex
PDB Compounds: (B:) Nuclear receptor subfamily 5 group A member 2

SCOPe Domain Sequences for d3tx7b_:

Sequence, based on SEQRES records: (download)

>d3tx7b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asiphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsive
warssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiias
qagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvn
aalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha

Sequence, based on observed residues (ATOM records): (download)

>d3tx7b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asiphlilellkcepdepqvqakimaylqqeqaklstfglmckmadqtlfsivewarssq
mkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqagatlnnlmshaqel
vaklrslqfdqrefvclkflvlfsldvqlvegvqeqvnaalldytmcnypqqtekfgqll
lrlpeiraismqaeeylyykhlngdvpynnlliemlha

SCOPe Domain Coordinates for d3tx7b_:

Click to download the PDB-style file with coordinates for d3tx7b_.
(The format of our PDB-style files is described here.)

Timeline for d3tx7b_: