SCOPe 2.04: Domain d3tuih1: 3tui H:0-240

Lineage for d3tuih1 (3tui H:0-240)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein automated matches [190723] (7 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [233742] (1 PDB entry)

8. Domain d3tuih1: 3tui H:0-240 [239836]
   Other proteins in same PDB: d3tuia_, d3tuib_, d3tuic2, d3tuid2, d3tuie_, d3tuif_, d3tuig2, d3tuih2
   automated match to d3tuid1
   complexed with adp

Details for d3tuih1

PDB Entry: 3tui, 2.9 Å

PDB Description: Inward facing conformations of the MetNI methionine ABC transporter: CY5 native crystal form

PDB Compounds: (H:) Methionine import ATP-binding protein metN

SCOPe Domain Sequences for d3tuih1:

Sequence; same for both SEQRES and ATOM records:

>d3tuih1 c.37.1.12 (H:0-240) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hmiklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpte
gsvlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkr
rvtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdqatsaldpattrsi
lellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqk
f

Timeline for d3tuih1:

• d3tuih1 is new in SCOPe 2.04-stable
  
• d3tuih1 appears in SCOPe 2.05
  
• d3tuih1 appears in the current release, SCOPe 2.08